DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG7142

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:348 Identity:78/348 - (22%)
Similarity:144/348 - (41%) Gaps:61/348 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 WRCEYLILGMLLLAELTQLGEAVTANQQRRNRRLRSDNGTKRLTGTKNQTGIRSNRRQGT-ARKL 88
            :||.|.:|...:.:.:..|..|              .:|:.:|...:...|.||.....| |..|
  Fly     5 YRCIYSVLLSTIASIMVVLSSA--------------SSGSIQLPTVRKCGGGRSAGAAHTMAMNL 55

  Fly    89 SAKRVNQNKKAATSSKIQS----RIVGGTSTTISTTPYIVQLRRGS------NLCSGSLITEQWV 143
            :|..:.:|:.:...:..|:    :.:.....|..:.||:|.::..:      :.|:|::|.|.|:
  Fly    56 AAYGLLENRISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWI 120

  Fly   144 LTAAHCVKGYSA-SDFTVRGGTTTLDGSDGVTRSVSSIHVAPKFTSKKMNM------DAALLKLN 201
            ||||||:....| .:..:..|:..:....|...::...|: ..:...::.:      |.||:...
  Fly   121 LTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHI-DYYVRHELYLGGVNPYDIALIYTK 184

  Fly   202 QSL---TGTNIGTISMGNYRPKA-GSRVRIAGWG-VTKEGSTTASKTLQTAQIRVVRQQKCRKDY 261
            :.|   |.....|:...:.:|:. |:   :.||| |:..........||.|.:.::..:.|.:..
  Fly   185 EPLVFDTYVQPATLPEQDAQPEGYGT---LYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQIL 246

  Fly   262 -RGQATITKYMLCA--RAAGKDSCSGDSGGPVTRN---------NTLLGIVSFG-YGCARAGYPG 313
             |....:.:..||.  ...|...|:.|||||:.:.         |.::||||:| ..|.:...|.
  Fly   247 ARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPS 311

  Fly   314 VYTAVVAIRQW-------ATNIM 329
            |:..|.|..:|       ||:||
  Fly   312 VFVRVSAFTEWINQVISTATHIM 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 56/246 (23%)
Tryp_SPc 121..324 CDD:238113 55/233 (24%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 57/245 (23%)
Tryp_SPc 84..323 CDD:214473 56/242 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.