DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG10405

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:248 Identity:86/248 - (34%)
Similarity:127/248 - (51%) Gaps:17/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LSAKRVNQNKKAATSSKIQSRIVGGTSTTISTTPYIVQLRRGS-NLCSGSLITEQWVLTAAHCVK 151
            |.|.|.    :||...:..||||.|...|....||.:.|||.: ::|..|:::..|.:|||||:.
  Fly    20 LEASRT----EAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCID 80

  Fly   152 GYSAS--DFTVRGGTTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTNIGTISM 214
            |:...  :||:|.| :.:..|.|..:.|.:|:..|.:....||.|.|||:.........:|.::.
  Fly    81 GHEQQPREFTLRQG-SIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPLGKVAP 144

  Fly   215 GNYRPKAGSRVR------IAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLC 273
            ... |..|..:.      ::|||.....:...|..|::..:..|.|:||..|.|....:|:.|.|
  Fly   145 IRL-PTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFC 208

  Fly   274 ARAAGKDSCSGDSGGPVTRNNTLLGIVSFGYGCARAGYPGVYTAVV--AIRQW 324
            |.|...|:|.||||||::...||:||||:|.|||...||||||.:.  .||:|
  Fly   209 AAARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRW 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 79/226 (35%)
Tryp_SPc 121..324 CDD:238113 74/213 (35%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 80/228 (35%)
Tryp_SPc 37..263 CDD:238113 79/227 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.