DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG11037

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:234 Identity:85/234 - (36%)
Similarity:127/234 - (54%) Gaps:5/234 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VNQNKKAATSSKIQSRIVGG-TSTTISTTPYIVQLRRGSN-LCSGSLITEQWVLTAAHCVKG-YS 154
            |.|..|....|..::|::|| .:|......|:..|....: :|.|:|:.|..|||||||..| ..
  Fly    46 VAQLAKIVLPSPHETRVIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIVLTAAHCFLGRMK 110

  Fly   155 ASDFTVRGGTTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTNIGTISMGNYRP 219
            ||::.|..|.:.|: ..|:.|.|....::.:|....||||.|::.|...|...||||:|:.:...
  Fly   111 ASEWIVAAGISNLN-QKGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPLKAKNIGTLSLCSVSL 174

  Fly   220 KAGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARAAG-KDSCS 283
            |.|..:.::|||:|..........|:|..:.::.::.||..|:..|.||..|:||...| ||:|:
  Fly   175 KPGVELVVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMICAAVLGRKDACT 239

  Fly   284 GDSGGPVTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIR 322
            .|||||:.....:.||||||.|||...||||||.|:.::
  Fly   240 FDSGGPLVFKKQVCGIVSFGIGCASNRYPGVYTDVMYVK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 81/219 (37%)
Tryp_SPc 121..324 CDD:238113 77/205 (38%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 81/219 (37%)
Tryp_SPc 62..283 CDD:238113 80/218 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455615
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.