DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and PRSS57

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_999875.2 Gene:PRSS57 / 400668 HGNCID:31397 Length:283 Species:Homo sapiens


Alignment Length:242 Identity:77/242 - (31%)
Similarity:117/242 - (48%) Gaps:30/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 SRIVGGTSTTISTTPYIVQLR-RGSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTTLDGS 170
            ::|:||...|..:.||:..:| .|.:.|.|.|:..:||::||||   :|..|  :|.|...| |:
Human    32 AQIIGGHEVTPHSRPYMASVRFGGQHHCGGFLLRARWVVSAAHC---FSHRD--LRTGLVVL-GA 90

  Fly   171 DGVTRS--------VSSIHVAPKFTSKKMNMDAALLKLNQS-LTGTNIGTISMGNYR---PKAGS 223
            ..::.:        :.::...|.:.......|..||:||.| :.|..:|.:.....|   |.||:
Human    91 HVLSTAEPTQQVFGIDALTTHPDYHPMTHANDICLLRLNGSAVLGPAVGLLRPPGRRARPPTAGT 155

  Fly   224 RVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARAAGKDS-----CS 283
            |.|:||||...: .......|..|::||:....|...::|..|:|  |||.|:.  ||     ||
Human   156 RCRVAGWGFVSD-FEELPPGLMEAKVRVLDPDVCNSSWKGHLTLT--MLCTRSG--DSHRRGFCS 215

  Fly   284 GDSGGPVTRNNTLLGIVSF-GYGCARAGYPGVYTAVVAIRQWATNIM 329
            .|||||:...|...|:||| |..|.....|.|||.|.|...|..:::
Human   216 ADSGGPLVCRNRAHGLVSFSGLWCGDPKTPDVYTQVSAFVAWIWDVV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 76/234 (32%)
Tryp_SPc 121..324 CDD:238113 72/221 (33%)
PRSS57NP_999875.2 Tryp_SPc 34..258 CDD:238113 76/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.