DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG10663

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:312 Identity:96/312 - (30%)
Similarity:139/312 - (44%) Gaps:37/312 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TQLGEAVTANQQRRNRRLRSDNGTKRLTGTKNQTGIRSNRRQGTARKLSAKRVNQNKKAATSSKI 105
            |:.|....||..||.:..:.:.....|.......|.|.  .:.|..|||...|    ::.|..:.
  Fly   442 TRPGSGSPANAMRRMQSEQPEVSMNDLNYIMTGKGYRG--PEYTPLKLSCGIV----RSGTGRRS 500

  Fly   106 QS---RIVGGTSTTISTTPYIVQL--RRGSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTT 165
            .|   :|:||.:......|:.|.:  |.....|.|:||..:|||||||||:    ....||.|..
  Fly   501 MSNMLKIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVR----KVLFVRIGEH 561

  Fly   166 TLDGSDG--VTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTN-IGTISMGNYRPKAGSRV-- 225
            .|:..||  :...|...:..|.|..:.::.|.|||:|.:::..|. ||...:..........|  
  Fly   562 NLNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDC 626

  Fly   226 RIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRK---DYRGQATITKYMLCA--RAAGKDSCSGD 285
            .|.|||..:....|.:..|..|.:.::..|.|||   ||    ||||.|.||  :....|:|:||
  Fly   627 TIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDY----TITKNMFCAGHQKGHIDTCAGD 687

  Fly   286 SGGPV-----TRNN---TLLGIVSFGYGCARAGYPGVYTAVVAIRQWATNIM 329
            ||||:     |:.|   |:.||.|||.|||:....|:|..|.....|..:::
  Fly   688 SGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVWSVV 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 79/235 (34%)
Tryp_SPc 121..324 CDD:238113 76/222 (34%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 79/236 (33%)
Tryp_SPc 507..735 CDD:238113 79/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455711
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.