DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG3650

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:241 Identity:107/241 - (44%)
Similarity:155/241 - (64%) Gaps:3/241 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 RKLSAKRVNQNKKAATSSKIQSRIVGGTSTTISTT-PYIVQLR-RGSNLCSGSLITEQWVLTAAH 148
            |.|...::.|......|.:||.||||||:||:|.. .::|.|| .|:..|.|||:|...|:||||
  Fly     3 RPLFLLQLTQLLLGLASGQIQPRIVGGTTTTLSAVGGFVVNLRYDGTFYCGGSLVTSSHVVTAAH 67

  Fly   149 CVKGYSASDFTVRGGTTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTNIGTIS 213
            |:|||.||..||:||.:.|..| ||.|.|:...:...|:|..:|.|..:::|..:|||:.|.||.
  Fly    68 CLKGYQASRITVQGGVSKLSQS-GVVRRVARYFIPNGFSSSSLNWDVGVIRLQSALTGSGITTIP 131

  Fly   214 MGNYRPKAGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARAAG 278
            :...:...|:.:|::|||.|:.|:::.|..|:|.:|:::|::.|::.|:|:.|:|....|||..|
  Fly   132 LCQVQWNPGNYMRVSGWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRAYQGRDTLTASTFCARTGG 196

  Fly   279 KDSCSGDSGGPVTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQW 324
            ||||||||||.|...|.|.||||:|.|||.|.||||||:|..:|.:
  Fly   197 KDSCSGDSGGGVIFKNQLCGIVSWGLGCANAQYPGVYTSVHRVRSF 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 101/217 (47%)
Tryp_SPc 121..324 CDD:238113 92/203 (45%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 101/219 (46%)
Tryp_SPc 26..243 CDD:238113 100/218 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455618
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.