DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG32833

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:233 Identity:68/233 - (29%)
Similarity:111/233 - (47%) Gaps:21/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 VGGTSTTISTTPYIVQLR-RGSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTTLDGSDGV 173
            :||....|:|.|:|..:. :....|.|::.....::||..||.|:......||.|:||  .||||
  Fly    39 LGGHPVNITTAPWIASISIKQKAKCDGAIYKLSHIVTAGKCVDGFLNKVIRVRVGSTT--RSDGV 101

  Fly   174 TR-SVSSIHVAPKFTSKKMNMDAALLKLNQSLTGT-NIGTISMGNYRPKAGSRVRIAGWG----- 231
            .. :|.:|.|..|||.:.:..:.|:|||.:.|..: .|..|.:.|..|..|::|...||.     
  Fly   102 IEVAVCNITVHEKFTGQTVFHNVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTANGWPSFRWW 166

  Fly   232 --VTKEGSTTASKTLQTAQIRVVRQQKC-----RKDYRGQATITKYMLCARAAGKDSCSGDSGGP 289
              ..|:.....:..||.|:::::...:|     |.:: .:...|..:.|.....|::||...|.|
  Fly   167 AMYWKKCLDDEAYKLQKAEVKLLGPSQCTDLWARNNW-SKKNFTDDLFCTEKFAKEACSLAMGSP 230

  Fly   290 VTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQWATN 327
            |..|..|:||::.| ||:.  ||.||..::..:.|..|
  Fly   231 VVHNGKLVGIITKG-GCSE--YPEVYINLIKYKDWLHN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 66/228 (29%)
Tryp_SPc 121..324 CDD:238113 62/217 (29%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 68/232 (29%)
Tryp_SPc 40..262 CDD:214473 66/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.