DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG8299

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:235 Identity:75/235 - (31%)
Similarity:120/235 - (51%) Gaps:16/235 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SSKIQSRIVGGTSTTISTTPYIVQLRRGS----NLCSGSLITEQWVLTAAHCVKGYSASDFTVRG 162
            |:.|.:.||||....|:..||.|.:|..:    ::|.||:...:.|:|||||:||..||...:..
  Fly    21 SASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIVA 85

  Fly   163 GTTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLT-GTNIGTISMGNYRPKAGSRVR 226
            |..::...:.....||.:.....:..|....|..|:...:.|. ...:..|::....|.:|::..
  Fly    86 GQNSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPPSGAQAV 150

  Fly   227 IAGWGVTKEGSTTASKTLQTAQIRVVRQQKC-----RKDYRGQATITKYMLCA--RAAGKDSCSG 284
            ::|||...|........|:..:::::.:..|     .|||    |:|..||||  ...|||:|:|
  Fly   151 VSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDY----TVTDEMLCAGYLEGGKDTCNG 211

  Fly   285 DSGGPVTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQW 324
            |||||:..:..|:|:||:|.||.|.|:|||||:|.:...|
  Fly   212 DSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDW 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 72/227 (32%)
Tryp_SPc 121..324 CDD:238113 67/214 (31%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 73/229 (32%)
Tryp_SPc 28..255 CDD:238113 73/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.