DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and Ser8

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:228 Identity:84/228 - (36%)
Similarity:126/228 - (55%) Gaps:8/228 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SSKIQSRIVGGTSTTISTTPYIVQLRR-GSNLCSGSLITEQWVLTAAHCV-KGYSASDFTVRGGT 164
            :|.:..||||||:::|...|:.|.|:| ||:.|.||:|:...::|||||: ...:.|:..:|.|:
  Fly    28 TSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGS 92

  Fly   165 TTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLT-GTNIGTISMGNYRPKAGSRVRIA 228
            .... ..||...|::|.....:.|.....|..:::|...|| |:.|..|:|.:..|..||...|:
  Fly    93 NKRT-YGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSAASIS 156

  Fly   229 GWGVTK-EGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITK-YMLCARAAGKDSCSGDSGGPVT 291
            |||.|. :|.::|  ||.....|:|.:.:|.....|..:..| .|:||.|..||:|.||||||:.
  Fly   157 GWGKTSTDGPSSA--TLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAAATNKDACQGDSGGPLV 219

  Fly   292 RNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQW 324
            ....|:|:||:|..||.|.|||||..:..:|.|
  Fly   220 SGGQLVGVVSWGRDCAVANYPGVYANIAELRDW 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 82/220 (37%)
Tryp_SPc 121..324 CDD:238113 75/207 (36%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 83/222 (37%)
Tryp_SPc 35..253 CDD:238113 82/221 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.