DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and thetaTry

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:228 Identity:94/228 - (41%)
Similarity:124/228 - (54%) Gaps:8/228 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QSRIVGGTSTTISTTPYIV--QLRRGSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTTLD 168
            :.|||||..|||...||.|  |.:.||:.|.||||.|..|:|||||:.|...|...||.| :||.
  Fly    32 EGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLG-STLY 95

  Fly   169 GSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGT-NIGTISMGNYRPKAGSRVRIAGWGV 232
            ...|:..:|..:.....:.||.|..|..:|||::.:..| ||..|.:....|..|:...:.||| 
  Fly    96 NEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPPTGTTAVVTGWG- 159

  Fly   233 TK--EGSTTASKTLQTAQIRVVRQQKCRKD-YRGQATITKYMLCARAAGKDSCSGDSGGPVTRNN 294
            :|  ....|..||||...:.:|..:.|..| |:....|...|:||....||:|.||||||:...|
  Fly   160 SKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYGEIIYDSMVCAYEKKKDACQGDSGGPLAVGN 224

  Fly   295 TLLGIVSFGYGCARAGYPGVYTAVVAIRQWATN 327
            ||:||||:||.||....||||:.|.|:|:|..|
  Fly   225 TLVGIVSWGYACASNLLPGVYSDVPALRKWILN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 92/221 (42%)
Tryp_SPc 121..324 CDD:238113 84/208 (40%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 92/222 (41%)
Tryp_SPc 35..255 CDD:238113 91/221 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.