DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and zetaTry

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster


Alignment Length:242 Identity:89/242 - (36%)
Similarity:126/242 - (52%) Gaps:20/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 RIVGGTSTTISTTPYIVQLR-RG--------SNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGG 163
            |||||.:|.|:..||.:.|| :|        .:.|.||:..|..::||||||.|..||.:.|..|
  Fly    38 RIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVVAG 102

  Fly   164 TTTLDGSDGVTRSVSSIHVAPKFTS-KKMNMDAALLKLNQSLTGTN--IGTISMGNYRPKAGSRV 225
            |....|||||..:|..|.:...:.| ...|.|.|:|.::..|...|  |..|.:...:|..|:..
  Fly   103 TNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGTVS 167

  Fly   226 RIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYR--GQAT--ITKYMLCA---RAAGKDSCS 283
            :::|||.|..|..::::.| ...:.:|..:.|.:||.  |..|  ||..||||   ...|.|:|.
  Fly   168 KVSGWGTTSPGGYSSNQLL-AVDVPIVSNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQ 231

  Fly   284 GDSGGPVTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQWATNIMA 330
            ||||||:...:.|.|:||:|..||...|||||..|..:|.|...::|
  Fly   232 GDSGGPLAVRDELYGVVSWGNSCALPNYPGVYANVAYLRPWIDAVLA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 87/234 (37%)
Tryp_SPc 121..324 CDD:238113 80/221 (36%)
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 87/235 (37%)
Tryp_SPc 39..276 CDD:238113 87/237 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.