DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG17571

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:223 Identity:87/223 - (39%)
Similarity:126/223 - (56%) Gaps:8/223 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 RIVGGTSTTISTTPY--IVQLRRGSNLCSGSLITEQWVLTAAHCVKGYSASDFTVR-GGTTTLDG 169
            |||.|....|...||  .||..:||:.|.||||..:.|||||||::.|:||:..|| |.|:...|
  Fly    30 RIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGSTSRSSG 94

  Fly   170 SDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTN-IGTISMGNYRPKAGSRVRIAGWGVT 233
            .:.||......|..  :.||.|..|.|::||:..:..|: |..|.:.:....:|:...::|||.|
  Fly    95 GEVVTVRAFKYHEG--YNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTT 157

  Fly   234 KEGSTTASKTLQTAQIRVVRQQKCRKD-YR-GQATITKYMLCARAAGKDSCSGDSGGPVTRNNTL 296
            .....::..|||..::.::..:.|..| |. |..:|.:.|:||....||:|.||||||:..:|.|
  Fly   158 CFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEKKDACQGDSGGPLVADNKL 222

  Fly   297 LGIVSFGYGCARAGYPGVYTAVVAIRQW 324
            :|:||:|.|||..||||||..|.::|.|
  Fly   223 VGVVSWGSGCAWTGYPGVYADVASLRSW 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 86/221 (39%)
Tryp_SPc 121..324 CDD:238113 81/208 (39%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 87/223 (39%)
Tryp_SPc 31..254 CDD:238113 86/222 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.