DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and Phae2

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:237 Identity:67/237 - (28%)
Similarity:114/237 - (48%) Gaps:14/237 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QSRIVGGTSTTISTTPYIVQLR-RGSNLCSGSLITEQWVLTAAHCVKGYS-ASDFTVRGGTTTLD 168
            :.|:|||.:...::.||||.:: .|::.|:.::|...|::|||||:...: ....|:..|:..:.
  Fly    29 EGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVA 93

  Fly   169 GSDGVT--RSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGT-NIGTISMGNYRPKAGSRVRIAGW 230
            |:...|  |.::...:...:|...:..|..|:....:.|.| .:..:.:.:...:...:..:.||
  Fly    94 GTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGW 158

  Fly   231 GVT-KEGSTTASKTLQTAQ-IRVVRQQKCRK--DYRGQATITKYMLCARAAGKDS-CSGDSGGPV 290
            |.| |..|.:..||||.|: |.::....|..  ..:||...|..:......|..| |:.|||||:
  Fly   159 GSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPL 223

  Fly   291 TRNNTLLGIVSFG-YGCARAGYPGVYTAVVAIRQWATNIMAN 331
            .:.|.|:||||:| ..|.:...|.||..|.:...|   |.||
  Fly   224 VQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITW---IAAN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 63/226 (28%)
Tryp_SPc 121..324 CDD:238113 59/213 (28%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 64/230 (28%)
Tryp_SPc 32..262 CDD:238113 64/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.