DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and Phae1

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:241 Identity:64/241 - (26%)
Similarity:112/241 - (46%) Gaps:22/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QSRIVGGTSTTISTTPYIVQLR-RGSNLCSGSLITEQWVLTAAHCV-KGYSASDFTVRGGTTTLD 168
            :.|:|||:...:::.||.|.:: .|::.|:.|::...|::|||||: ........|:..|:..:|
  Fly    33 EGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAGSIAVD 97

  Fly   169 G--SDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLT-GTNIGTISMGNYRPKAG----SRVR 226
            |  |...|||::...:...:|...:..|..::....:.. ...:..:::    |.:|    ....
  Fly    98 GTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTL----PSSGVVPTGTAN 158

  Fly   227 IAGWGVTKEGSTTA-SKTLQTA-QIRVVRQQKCRKDYRGQAT-ITKYMLCA--RAAGKDSCSGDS 286
            :.|||.|...:|.: ..|||.| .:.::....|......:.: :....||.  ...|...|:.||
  Fly   159 LYGWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDS 223

  Fly   287 GGPVTRNNTLLGIVSFG-YGCARAGYPGVYTAVVAIRQWATNIMAN 331
            |||:.:.|.|:||||:| ..|.:|..|.||..|.:...|   |.||
  Fly   224 GGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISW---ISAN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 60/230 (26%)
Tryp_SPc 121..324 CDD:238113 56/217 (26%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 61/234 (26%)
Tryp_SPc 36..266 CDD:238113 61/236 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.