DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and PRSS53

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:267 Identity:67/267 - (25%)
Similarity:107/267 - (40%) Gaps:64/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PYIVQLRR-GSNLCSGSLITEQWVLTAAHCVKGYSASD---FTVRGGTTTLDG-SDGVTR-SVSS 179
            |:...:|| |:::|||||:.:.||||||||.:..:|::   ::|..|:...:| |.|... .|::
Human    49 PWQASVRRQGAHICSGSLVADTWVLTAAHCFEKAAATELNSWSVVLGSLQREGLSPGAEEVGVAA 113

  Fly   180 IHVAPKFTSKKMNMDAALLKLNQSLTGTNIGTISMGNYRPKAGSRVRIAGWGV-TKEG------- 236
            :.:...:.......|.|||:|....|.|.: .:....:|...|:.....||.. |.:|       
Human   114 LQLPRAYNHYSQGSDLALLQLAHPTTHTPL-CLPQPAHRFPFGASCWATGWDQDTSDGKCWPRLK 177

  Fly   237 --------STTASK----------------------------TLQTAQIRVVRQQKCRKDYR--G 263
                    |.|.|.                            ||:..::|::.:..|...|.  .
Human   178 LGEALCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPTCNCIYNQLH 242

  Fly   264 QATITK----YMLCA--RAAGKDSCSGDSGGPV-----TRNNTLLGIVSFGYGCARAGYPGVYTA 317
            |..::.    .|||.  :...:..|.|||||||     ..:....||:||...||:...|.:.|.
Human   243 QRHLSNPARPGMLCGGPQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISFASSCAQEDAPVLLTN 307

  Fly   318 VVAIRQW 324
            ..|...|
Human   308 TAAHSSW 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 66/265 (25%)
Tryp_SPc 121..324 CDD:238113 66/265 (25%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 67/267 (25%)
Tryp_SPc 43..314 CDD:214473 66/265 (25%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.