DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG31954

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:232 Identity:81/232 - (34%)
Similarity:127/232 - (54%) Gaps:14/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SSKIQSRIVGGTSTTISTTPYIVQLRRGSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTT 166
            |.::..|||||....|:..|:.|.|:..|::|.||:|:|:|:||||||..|.:|....||.||:.
  Fly    44 SPRLDGRIVGGHRINITDAPHQVSLQTSSHICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSE 108

  Fly   167 LDGSDGVTRSVSSIHVAPKFTSKKMNMDAALL------KLNQSLTGTNIGTISMGNYRPKAGSRV 225
            ...|..:.| |..|....:|....::.|.:||      |.:::.....:....|   :...|...
  Fly   109 FARSGQLLR-VQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQM---KYMDGEAC 169

  Fly   226 RIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCA--RAAGKDSCSGDSGG 288
            .::|||.| :....:.:.|:..::.:|.|:.|.:.|:....:|:.|:||  ...|||:|.|||||
  Fly   170 FVSGWGNT-QNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDACQGDSGG 233

  Fly   289 P-VTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQW 324
            | |:.:..|:|:||:|||||:..|||||:.|...|.|
  Fly   234 PMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDW 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 79/224 (35%)
Tryp_SPc 121..324 CDD:238113 73/211 (35%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 80/226 (35%)
Tryp_SPc 51..274 CDD:238113 79/225 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.