DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG4271

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:196 Identity:58/196 - (29%)
Similarity:89/196 - (45%) Gaps:5/196 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 GSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTTLDGSDGVTRSVSSIHVAPKFTSKKMNM 193
            |.:.|.|::|..:.|||||.|||.......|||.||..:.....:.| |:::.|...:  |..:.
  Fly    40 GYHECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDIYRGGRIIR-VTALVVHENY--KNWDN 101

  Fly   194 DAALLKLNQSLTGTNIGTISMGNYRPKAGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCR 258
            |.|||.|.:.:....:..|.:....|........||||.....|...::.||....::..:..|.
  Fly   102 DIALLWLEKPVLSVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCA 166

  Fly   259 KDYRGQATITKYMLCARAAGKDSCSGDSGGPVTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQ 323
            ::.  ...:.:.:|||.....|.|.||.|||:...|.::||...|:||..|..|.:||.|....:
  Fly   167 EEL--VEPVGEELLCAFYTENDICPGDYGGPLVLANKVVGIAVQGHGCGFAVLPSLYTNVFHYLE 229

  Fly   324 W 324
            |
  Fly   230 W 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 57/194 (29%)
Tryp_SPc 121..324 CDD:238113 57/194 (29%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 58/196 (30%)
Tryp_SPc 19..231 CDD:214473 58/196 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.