DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG1304

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:236 Identity:71/236 - (30%)
Similarity:110/236 - (46%) Gaps:21/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IQSRIVGGTSTTISTTPYIVQLRR-GSNLCSGSLITEQWVLTAAHCVKG---------YSASDFT 159
            :..|:|||.....:..|:.|.||. ||:.|.||:::..:||||||||..         .:|..||
  Fly    28 LNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFT 92

  Fly   160 VRGGTTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSL-TGTNIGTISMGNYRPKAGS 223
            :|.|:.. ..|.||...|:.:.|..:: ...:| |.|||:|...| ...:|..|.:......|..
  Fly    93 IRAGSND-RFSGGVLVQVAEVIVHEEY-GNFLN-DVALLRLESPLILSASIQPIDLPTADTPADV 154

  Fly   224 RVRIAGWG-VTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLC-ARAAGKDSCSGDS 286
            .|.|:||| :..:|.  ..:.||...::.:..::| .:..|....::  || ...|...:|:|||
  Fly   155 DVIISGWGRIKHQGD--LPRYLQYNTLKSISLERC-DELIGWGVQSE--LCLIHEADNGACNGDS 214

  Fly   287 GGPVTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQWATN 327
            |||...||.::|:..|.:......||..|..|....:|..|
  Fly   215 GGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIKN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 69/228 (30%)
Tryp_SPc 121..324 CDD:238113 65/215 (30%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 69/229 (30%)
Tryp_SPc 32..256 CDD:238113 70/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.