DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and Prss53

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:223 Identity:62/223 - (27%)
Similarity:102/223 - (45%) Gaps:23/223 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PYIVQLRR-GSNLCSGSLITEQWVLTAAHCVKGYSA---SDFTVRGGTTTLDG-SDGVTR-SVSS 179
            |:...:|| |.::|||||:.:.||||||||.:..:.   |.::|..|:...:| |.|... .|::
Mouse    49 PWQASVRRQGVHICSGSLVADTWVLTAAHCFEKMATAELSSWSVVLGSLKQEGQSPGAEEVGVAA 113

  Fly   180 IHVAPKFTSKKMNMDAALLKLNQSLTGTNIGTISMGNYRPKAGSRVRIAGWGVTKEGSTTASKTL 244
            :.:...:.......|.|||:|......|.: .:....|....|:.....||   .:.::..|:||
Mouse   114 LQLPKAYNHYSQGSDLALLQLTHPTVQTTL-CLPQPTYHFPFGASCWATGW---DQNTSDVSRTL 174

  Fly   245 QTAQIRVVRQQKCRKDYR--GQATITK----YMLC--ARAAGKDSCSGDSGGPVTRNN-----TL 296
            :..::|::.:..|...|.  .|..::.    .|||  |:...:..|.|||||||....     ..
Mouse   175 RNLRLRLISRPTCNCLYNRLHQRLLSNPARPGMLCGGAQPGEQGPCQGDSGGPVMCREPDGHWVQ 239

  Fly   297 LGIVSFGYGCARAGYPGVYTAVVAIRQW 324
            :||:||...||:...|.:.|.:.....|
Mouse   240 VGIISFTSKCAQEDTPVLLTDMAVHSSW 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 61/221 (28%)
Tryp_SPc 121..324 CDD:238113 61/221 (28%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46
Tryp_SPc 45..271 CDD:238113 62/223 (28%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.