DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG33159

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:225 Identity:98/225 - (43%)
Similarity:138/225 - (61%) Gaps:4/225 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SSKIQSRIVGGTSTTISTTPYIVQLRR-GSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTT 165
            ||..::|||||..||||..||:|.||: |..:|.||||:.:.||:|||||.|.....|||..|.:
  Fly    19 SSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGAS 83

  Fly   166 TLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQ--SLTGTNIGTISMGNYRPKAGSRVRIA 228
            .||....|.|:|...|.:|.:::...:||.|||:|.:  .||...:.|||.....|:..:..||:
  Fly    84 RLDQEAPVVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPPEGNAYARIS 148

  Fly   229 GWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARAAG-KDSCSGDSGGPVTR 292
            |||||:|.:...::.::|..:||:...:|:..|.|...::..||||...| :||||||||||:..
  Fly   149 GWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAAVRGLRDSCSGDSGGPLVY 213

  Fly   293 NNTLLGIVSFGYGCARAGYPGVYTAVVAIR 322
            ...:.||||:|:||||..:|||||.|.:.|
  Fly   214 RGQVCGIVSWGFGCARPSFPGVYTNVASER 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 96/219 (44%)
Tryp_SPc 121..324 CDD:238113 87/206 (42%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 95/215 (44%)
Tryp_SPc 26..251 CDD:238113 95/218 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455614
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.