DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG31681

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:235 Identity:75/235 - (31%)
Similarity:117/235 - (49%) Gaps:12/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QSRIVGGTSTTISTTPYIVQLRRGS-NLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTTLDG 169
            :.|||||:...|...|:.|.::..| :.|.|.:.:::.:||||||:...:.:|.:||.|::....
  Fly    26 EERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSNVTVTDLSVRAGSSYWSK 90

  Fly   170 SDGVTRSVSSIHVAPKFTSKKMN-MDAALLKLNQSL-TGTNIGTISMGNYRPKAGSRVRIAGWGV 232
            ...|.:.:.:| ..||:..|..| .|.|:|.|...| .|..:..|.:....|.||:.|..:|||.
  Fly    91 GGQVLKVLKTI-AHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGY 154

  Fly   233 TKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARAAGKDSCSGDSGGPVTR----- 292
            |:|.|:.....||...:.::.:..|.|.|: ...||..|:||.....|:|.||||||:..     
  Fly   155 TRENSSFLWPILQGVHVAILNRTDCLKAYK-HVNITIDMICADGQRWDTCQGDSGGPLIETTKGG 218

  Fly   293 NNTLLGIVSFGYGCARAGYPGVYTAVVAIRQWATNIMANN 332
            :..|:|:||:|.||..  .||||..:.....|....:..|
  Fly   219 HRQLIGMVSWGDGCGT--NPGVYEDIAFFHNWIKYTVKKN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 73/223 (33%)
Tryp_SPc 121..324 CDD:238113 67/210 (32%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 73/224 (33%)
Tryp_SPc 29..250 CDD:238113 73/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.