DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG31267

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:249 Identity:77/249 - (30%)
Similarity:124/249 - (49%) Gaps:26/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KRVNQNKKAATSSKIQSRIVGGTSTTISTTPYIVQLRR--GSNLCSGSLITEQWVLTAAHCVKGY 153
            :|...::|:.|::|..||||||..:.:...||:|.|:.  |::.|:||:|.:|||:|||.|:.|.
  Fly    27 RRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGL 91

  Fly   154 SASDFTVRGGTTTLD--GSDGVTRSVSSIHVAPKFTSKKMNMDAALLK---------LNQSLTGT 207
            ..::  |:..|||.:  ||:|...||..|.:...|.|...:.|.||:|         :.|::|..
  Fly    92 RKNN--VQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIA 154

  Fly   208 NIGTISMGNYRPKAGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYML 272
            .:..::       .|..:.:.|:|.|:.|. ..|..||...:..|..:||...|.|...:....|
  Fly   155 PLEDLT-------DGETLTMYGYGSTEIGG-DFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHL 211

  Fly   273 CA-RAAGKDSCSGDSGGP-VTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQW 324
            || ...|..:|.||:||| |.....|:|:.::|..|. .|:|.|:..:.....|
  Fly   212 CAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCG-YGFPDVFARISFYYSW 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 71/230 (31%)
Tryp_SPc 121..324 CDD:238113 66/217 (30%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 72/232 (31%)
Tryp_SPc 45..268 CDD:238113 71/231 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.