DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG32834

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:243 Identity:79/243 - (32%)
Similarity:114/243 - (46%) Gaps:27/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QSRIVGGTSTTISTTPYIVQ-LRRGSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTTLD- 168
            ||||:||....|...||..: :..|:.:|||::||...::|||.||:.|.:.:  ||.||::.| 
  Fly    24 QSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITAASCVQSYGSIE--VRVGTSSRDY 86

  Fly   169 GSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSL-TGTNIGTISMGNYRPKAGSRVRIAGWGV 232
            ...|....|..|...|::...:.:.:.|||||...| |...|..||:....|..||...::|||.
  Fly    87 DGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSEAIQPISIAEDEPDDGSWCTVSGWGS 151

  Fly   233 TKEGST-------TASKTLQTAQIRVVRQQKCRKDYRG------QATITKYMLCARAAGKDSCSG 284
            |....:       :....||.|.:.|..:::|..| ||      ...|:...||.. .|...||.
  Fly   152 TSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCAAD-RGVWFGLWDNGISYLTLCTH-NGAGGCSY 214

  Fly   285 DSGGPVTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQWATNIMANN 332
            |:|.|:..:..|:||:|.| ||...  |.||..|    .|.|..:|.|
  Fly   215 DTGAPLVIDGQLVGILSEG-GCTTK--PDVYANV----PWFTGWIAEN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 73/231 (32%)
Tryp_SPc 121..324 CDD:238113 68/218 (31%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 75/236 (32%)
Tryp_SPc 27..255 CDD:238113 75/238 (32%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.