DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG32808

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:239 Identity:82/239 - (34%)
Similarity:122/239 - (51%) Gaps:19/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ATSSKIQSRIVGGTSTTISTTPYIVQLRR---GSNLCSGSLITEQWVLTAAHCVKGYSASDFTVR 161
            |.:|....:||.||:......|::|.|||   |.:.|..:|:...|||||||||:|.|.....::
  Fly    21 AGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTAAHCVRGSSPEQLDLQ 85

  Fly   162 GGTTTLDGSDGVTRSVSSIHVAPKF--TSKKMNMDAALLKLNQSLTGTN-IGTISMGNYR---PK 220
            .|:..|..:......|::|.|.|.:  ..|.:| |.|||:|.||:..:. :..:.:...|   |.
  Fly    86 YGSQMLARNSSQVARVAAIFVHPGYEPEDKYVN-DIALLQLAQSVALSKFVQPVRLPEPRQVTPG 149

  Fly   221 AGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCA--RAAGKDSCS 283
            ..|.| :||||:...|. ...:.||..:::|....:|.:  |.|..:....:||  ...||..||
  Fly   150 NASAV-LAGWGLNATGG-VVQQHLQKVKLQVFSDTECSE--RHQTYLHDSQICAGLPEGGKGQCS 210

  Fly   284 GDSGGP--VTRNNTLLGIVSFGY-GCARAGYPGVYTAVVAIRQW 324
            ||||||  :..::|.:||||:.. .|||..:|||:|.|.|...|
  Fly   211 GDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVDW 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 79/229 (34%)
Tryp_SPc 121..324 CDD:238113 75/216 (35%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 80/231 (35%)
Tryp_SPc 30..258 CDD:238113 80/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.