DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG32376

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:286 Identity:87/286 - (30%)
Similarity:124/286 - (43%) Gaps:38/286 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DNGT--------KRLTGTKNQTGIRSNRRQGTARKLSAKRVNQNKKAATSSKIQSRIVGGTSTTI 117
            ||||        :.:..|.|...|.||   .....|.|:           ....:|||.|.....
  Fly    24 DNGTHYLLYGKPEDIAPTPNFGNISSN---PFINALEAQ-----------ESFPTRIVNGKRIPC 74

  Fly   118 STTPYIVQLR-RGSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTTLDGSD-----GVTRS 176
            :..|:...|. .|..:|...:|.:.|:|||.||..| ....:|||      .|||     |..|.
  Fly    75 TEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFG-PPEKYTVR------VGSDQQRRGGQLRH 132

  Fly   177 VSSIHVAPKFTSKKMNMDAALLKLNQSL-TGTNIGTISMGNYR-PKAGSRVRIAGWGVTKEGSTT 239
            |..|.....:....|..|.|::||...: .|..:..:.:.:.: .|...:..::|||:|...:..
  Fly   133 VKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKFVVSGWGITSANAQN 197

  Fly   240 ASKTLQTAQIRVVRQQKCRKDY-RGQATITKYMLCARAAGKDSCSGDSGGPVTRNNTLLGIVSFG 303
            ..:.|:..||..:::.||:|.| :....|.|.|:||....|||||||||||:|....|.||||:|
  Fly   198 VQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICASRTNKDSCSGDSGGPLTSRGVLYGIVSWG 262

  Fly   304 YGCARAGYPGVYTAVVAIRQWATNIM 329
            .|||...|||||........|...::
  Fly   263 IGCANKNYPGVYVNCKRYVPWIKKVI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 75/224 (33%)
Tryp_SPc 121..324 CDD:238113 71/211 (34%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 75/225 (33%)
Tryp_SPc 66..287 CDD:238113 75/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.