DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG6041

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:275 Identity:88/275 - (32%)
Similarity:123/275 - (44%) Gaps:58/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LSAKRVNQNKKAATSSKIQSRIVGGTSTTISTTPYIVQLRRGSN---------LCSGSLITEQWV 143
            |.|....::..:.|:.||:.:||||...:|....|.|.:|..:|         ||.|.:|:::.|
  Fly    14 LGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLV 78

  Fly   144 LTAAHCV-----KGY-SASDFTVRGGTTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDA------- 195
            .|||||.     |.| :|.:|.:..|:|.|..|   |......::....|.:..|.||       
  Fly    79 ATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSS---TDRTLMYYLQQLITHENYNPDALTNDIAL 140

  Fly   196 --------------ALLKLNQSLTGTNIGTISMGNYRPKAGSRVRIAGWGVTKEGSTTASKTLQT 246
                          ..|.||..|..||...:              |:|||:.::..|.:|.|||.
  Fly   141 MFINGYIPWNWPTVTALALNSQLVATNTDCL--------------ISGWGLLQQNGTFSSNTLQA 191

  Fly   247 AQIRVVRQQKCRKDYRGQATITKYMLCA--RAAGKDSCSGDSGGPVTRNNTLLGIVSFGYGCARA 309
            |.:.:|....||..|.   :|....:||  .:.|.|:|.||||||::.|..|.||||:|.|||..
  Fly   192 ATVPIVSYTTCRISYN---SIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAP 253

  Fly   310 GYPGVYTAVVAIRQW 324
            |||||||.|.....|
  Fly   254 GYPGVYTNVSYYYDW 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 82/253 (32%)
Tryp_SPc 121..324 CDD:238113 77/240 (32%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 83/255 (33%)
Tryp_SPc 35..272 CDD:238113 83/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455632
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.