DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and CG3795

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:270 Identity:79/270 - (29%)
Similarity:118/270 - (43%) Gaps:30/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 SNRRQGTARKLSAKRVNQNKKAATSSKIQSRIVGG-TSTTISTTPYIVQLRRG--------SNLC 133
            ||......:..||....|::    .|..|..:.|| ...|.....|.|.||.|        ::.|
  Fly    19 SNSESQAGQLHSAPSQRQDR----PSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKFFGDNHFC 79

  Fly   134 SGSLITEQWVLTAAHCV----KGYSASDFTVRGGTTTLDGSDGVTRSVSSIHVAP-----KFTSK 189
            :|::.:|:.:||||||:    :...|....|..||.........|:.:.:..:.|     |..|:
  Fly    80 AGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHPKYKKGKSQ 144

  Fly   190 KMNMDAALLKLNQSLTGTNIGTISMGNYRPKAGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQ 254
            |.::...||:.:.|| |..:..|.:.|..|.||:...|.|||...:......:.: ...::::..
  Fly   145 KYDIGLILLEADLSL-GDAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGPLPDEAI-NGDMQILPD 207

  Fly   255 QKCRKDYRGQATITKYMLCA---RAAGKDSCSGDSGGPVTRNNTLLGIVSFGYGCARAGYPGVYT 316
            ..|.| ..|.:...  ||||   ..:..|||.||||||:..:|.:.||||||.||......|:||
  Fly   208 TFCEK-LLGWSNAG--MLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCGEPDSAGIYT 269

  Fly   317 AVVAIRQWAT 326
            .|...|.|.|
  Fly   270 DVYHFRDWIT 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 70/236 (30%)
Tryp_SPc 121..324 CDD:238113 67/222 (30%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 69/225 (31%)
Tryp_SPc 60..278 CDD:214473 67/222 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.