DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and LOC286960

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:229 Identity:81/229 - (35%)
Similarity:115/229 - (50%) Gaps:8/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 RIVGGTSTTISTTPYIVQLRRG-SNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTTLDGSD 171
            :||||.:......||.|.|..| |:.|.||||::||||:||||.|    ....||.|...:...:
  Rat    23 KIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYK----RKLQVRLGEHNIHVLE 83

  Fly   172 GVTRSVSSIHVA--PKFTSKKMNMDAALLKL-NQSLTGTNIGTISMGNYRPKAGSRVRIAGWGVT 233
            |..:.:.:..:.  |::....::.|..|:|| :.::..:.:.|:|:........::..::|||.|
  Rat    84 GGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQCLVSGWGNT 148

  Fly   234 KEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARAAGKDSCSGDSGGPVTRNNTLLG 298
            ..........||..:..|:....|:|.|.||.|...:.|.....|||||.|||||||..|..:.|
  Rat   149 VSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQG 213

  Fly   299 IVSFGYGCARAGYPGVYTAVVAIRQWATNIMANN 332
            |||:|..||..|.|||||.|.....|....||||
  Rat   214 IVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 76/219 (35%)
Tryp_SPc 121..324 CDD:238113 72/206 (35%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 76/220 (35%)
Tryp_SPc 24..243 CDD:238113 77/222 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.