DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and Klkb1

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:344 Identity:105/344 - (30%)
Similarity:158/344 - (45%) Gaps:59/344 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISGNKSRGKVIAKTVHSDMLWRCEYLILGMLLLAELTQLGEAVTANQQRRNRRLRSDNGTKRLTG 69
            :.|..:..:...||:      ||::....:        |.:...|...:.:.||.:|....|:| 
  Rat   312 VQGADACQETCTKTI------RCQFFTYSL--------LPQDCKAEGCKCSLRLSTDGSPTRIT- 361

  Fly    70 TKNQTGIRSNRRQGTA-RKLSAKRVNQNKKAATSSKIQSRIVGGTSTTISTTPYIVQLR----RG 129
                     ...||:: ..|...:|.::....|  ||.:||||||::::...|:.|.|:    ..
  Rat   362 ---------YEAQGSSGYSLRLCKVVESSDCTT--KINARIVGGTNSSLGEWPWQVSLQVKLVSQ 415

  Fly   130 SNLCSGSLITEQWVLTAAHCVKGYSASD-FTVRGGTTTLDGSDGVT--RSVSSIHVAPKFTSKKM 191
            :::|.||:|..||:||||||..|....| :.:.||...|......|  .|:..:.:..|:...:.
  Rat   416 NHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEG 480

  Fly   192 NMDAALLKLNQSLTGTNIGTISMGNYRP-----KAGSRV-----RIAGWGVTKEGSTTASKTLQT 246
            :.|.||:||...|..|..       .:|     ||.:..     .:.|||.|||...| ...||.
  Rat   481 SYDIALIKLQTPLNYTEF-------QKPICLPSKADTNTIYTNCWVTGWGYTKERGET-QNILQK 537

  Fly   247 AQIRVVRQQKCRKDYRGQATITKYMLCA--RAAGKDSCSGDSGGPVTRNNT----LLGIVSFGYG 305
            |.|.:|..::|:|.|| ...|||.|:||  :..|.|:|.||||||:...::    |:||.|:|.|
  Rat   538 ATIPLVPNEECQKKYR-DYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEG 601

  Fly   306 CARAGYPGVYTAVVAIRQW 324
            |||...|||||.|.....|
  Rat   602 CARKEQPGVYTKVAEYIDW 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 85/238 (36%)
Tryp_SPc 121..324 CDD:238113 79/225 (35%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519 15/86 (17%)
Tryp_SPc 390..621 CDD:214473 86/240 (36%)
Tryp_SPc 391..621 CDD:238113 85/239 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.