DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and Prss2

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_033456.1 Gene:Prss2 / 22072 MGIID:102759 Length:246 Species:Mus musculus


Alignment Length:230 Identity:88/230 - (38%)
Similarity:119/230 - (51%) Gaps:11/230 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 RIVGGTSTTISTTPYIVQLRRGSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTTLDGSDG 172
            :||||.:...|:.||.|.|..|.:.|.||||.:|||::||||.| |.   ..||.|...::..:|
Mouse    23 KIVGGYTCRESSVPYQVSLNAGYHFCGGSLINDQWVVSAAHCYK-YR---IQVRLGEHNINVLEG 83

  Fly   173 VTRSVSSIHVA--PKFTSKKMNMDAALLKLNQSLT-GTNIGTISMGNYRPKAGSRVRIAGWGVTK 234
            ..:.|.|..:.  |.:.|..::.|..|:||...:| ...:.::.:.:....||::..|:|||.|.
Mouse    84 NEQFVDSAKIIRHPNYNSWTLDNDIMLIKLASPVTLNARVASVPLPSSCAPAGTQCLISGWGNTL 148

  Fly   235 EGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCA--RAAGKDSCSGDSGGPVTRNNTLL 297
            .........||.....|:.|..|...|.|.  ||..|:|.  ...|||||.|||||||..|..|.
Mouse   149 SNGVNNPDLLQCVDAPVLPQADCEASYPGD--ITNNMICVGFLEGGKDSCQGDSGGPVVCNGELQ 211

  Fly   298 GIVSFGYGCARAGYPGVYTAVVAIRQWATNIMANN 332
            ||||:|||||:...|||||.|.....|..|.:|:|
Mouse   212 GIVSWGYGCAQPDAPGVYTKVCNYVDWIQNTIADN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 84/220 (38%)
Tryp_SPc 121..324 CDD:238113 79/207 (38%)
Prss2NP_033456.1 Tryp_SPc 23..239 CDD:214473 84/221 (38%)
Tryp_SPc 24..242 CDD:238113 85/223 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.