DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and Klkb1

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_032481.2 Gene:Klkb1 / 16621 MGIID:102849 Length:638 Species:Mus musculus


Alignment Length:332 Identity:105/332 - (31%)
Similarity:153/332 - (46%) Gaps:59/332 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KTVHSDMLWRCEYLILGMLLLAELTQLGEAVTANQQRRNRRLRSDNGTKRLT-GTKNQTGIRSNR 80
            ||:      ||::.|.. ||..:..:.|       .:.:.||.:|....|:| |.:..:|     
Mouse   324 KTI------RCQFFIYS-LLPQDCKEEG-------CKCSLRLSTDGSPTRITYGMQGSSG----- 369

  Fly    81 RQGTARKLSAKRVNQNKKAATSSKIQSRIVGGTSTTISTTPYIVQLR----RGSNLCSGSLITEQ 141
                   .|.:..........::||.:||||||:.::...|:.|.|:    ..::||.||:|..|
Mouse   370 -------YSLRLCKLVDSPDCTTKINARIVGGTNASLGEWPWQVSLQVKLVSQTHLCGGSIIGRQ 427

  Fly   142 WVLTAAHCVKGYSASD-FTVRGGTTTLDGSDGVTRS--VSSIHVAPKFTSKKMNMDAALLKLNQS 203
            ||||||||..|....| :.:.||..:|......|.|  :..:.:..::...:.|.|.||:||...
Mouse   428 WVLTAAHCFDGIPYPDVWRIYGGILSLSEITKETPSSRIKELIIHQEYKVSEGNYDIALIKLQTP 492

  Fly   204 LTGTNIGTISMGNYRP-----KAGSRV-----RIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCR 258
            |..|..       .:|     ||.:..     .:.|||.|||...| ...||.|.|.:|..::|:
Mouse   493 LNYTEF-------QKPICLPSKADTNTIYTNCWVTGWGYTKEQGET-QNILQKATIPLVPNEECQ 549

  Fly   259 KDYRGQATITKYMLCA--RAAGKDSCSGDSGGPVTRNNT----LLGIVSFGYGCARAGYPGVYTA 317
            |.|| ...|.|.|:||  :..|.|:|.||||||:...::    |:||.|:|.||||...|||||.
Mouse   550 KKYR-DYVINKQMICAGYKEGGTDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKDQPGVYTK 613

  Fly   318 VVAIRQW 324
            |.....|
Mouse   614 VSEYMDW 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 86/238 (36%)
Tryp_SPc 121..324 CDD:238113 80/225 (36%)
Klkb1NP_032481.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519 16/76 (21%)
Tryp_SPc 390..621 CDD:214473 87/240 (36%)
Tryp_SPc 391..621 CDD:238113 86/239 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.