DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32269 and Gm2663

DIOPT Version :9

Sequence 1:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001096130.1 Gene:Gm2663 / 100040208 MGIID:3780832 Length:247 Species:Mus musculus


Alignment Length:237 Identity:83/237 - (35%)
Similarity:117/237 - (49%) Gaps:8/237 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ATSSKIQSRIVGGTSTTISTTPYIVQLRRG-SNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGG 163
            |..:....:||||.:....:.||.|.|..| |:.|.||||.:||||:||||.|    ....||.|
Mouse    15 ALPANSDDKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLINDQWVLSAAHCYK----RRLQVRLG 75

  Fly   164 TTTLDGSDGVTRSVSSIHVA--PKFTSKKMNMDAALLKL-NQSLTGTNIGTISMGNYRPKAGSRV 225
            ...:|..:|..:.:.:..:.  |.:....::.|..|:|| :.::..:.:.|:|:........::.
Mouse    76 EHNIDVLEGGEQFIDAEKIIRHPDYNKDTVDNDIMLIKLKSPAILNSQVSTVSLPRSCASTNAQC 140

  Fly   226 RIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARAAGKDSCSGDSGGPV 290
            .::|||.|..........||..:..|:....|:|.|.||.|...:.|.....|||||.|||||||
Mouse   141 LVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPV 205

  Fly   291 TRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQWATNIMANN 332
            ..|..:.||||:|..||..|.|||||.|.....|....||||
Mouse   206 VCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 77/219 (35%)
Tryp_SPc 121..324 CDD:238113 73/206 (35%)
Gm2663NP_001096130.1 Tryp_SPc 23..240 CDD:214473 77/220 (35%)
Tryp_SPc 24..243 CDD:238113 78/222 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.