DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11714 and BTBD6

DIOPT Version :9

Sequence 1:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001374496.1 Gene:BTBD6 / 90135 HGNCID:19897 Length:538 Species:Homo sapiens


Alignment Length:345 Identity:82/345 - (23%)
Similarity:136/345 - (39%) Gaps:81/345 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PNSKMRSCMM---ELGRTNRHTDCTFIIEDESGGSQSFPCHKLLFSCASDVFDRMLYGDYIESTS 71
            |..:.|:.:|   ||     ..|..|:: ...|.:::.|.||.:.:..|.||..|.|||..|..|
Human   120 PTLRERNALMFNNEL-----MADVHFVV-GPPGATRTVPAHKYVLAVGSSVFYAMFYGDLAEVKS 178

  Fly    72 GVVRLNDVQPDIFEKFRDYVYGYECDKLQKYDFDTLIRLCEFANKYLVQSLEEDCVKDL---LIR 133
             .:.:.||:|..|.....|:|..|.|    .:.||::.....|.||:|.:|.:.||..|   |..
Human   179 -EIHIPDVEPAAFLILLKYMYSDEID----LEADTVLATLYAAKKYIVPALAKACVNFLETSLEA 238

  Fly   134 KNTFDMGELLRLFQCAHRMNRKSLINQIAWE-LKCTFKSTLDHSGVYEFNCEVFKHYIEVIASKI 197
            ||...:....|||:       :..:.|..|| :....:..|...|.    ||:.:..:|:|.:: 
Human   239 KNACVLLSQSRLFE-------EPELTQRCWEVIDAQAEMALRSEGF----CEIDRQTLEIIVTR- 291

  Fly   198 SEADRFRLLEMYLKYNGIEELESAGQVDSQDAT--EANTTTITTTNEVENQESELPSTSCVPLKT 260
             ||                       :::::|.  ||    :....|.|.:...||.|       
Human   292 -EA-----------------------LNTKEAVVFEA----VLNWAEAECKRQGLPIT------- 321

  Fly   261 ECSFAVPNKKASFVSDLLALIDFGKLSPKEFYDGPGKSNFLSLAEKYE-HMYQIAKNCVTAKDEL 324
                  |..|...:...|.|:....::.:||.:|..:|:.|:|.|.:. .::..|.|    |..|
Human   322 ------PRNKRHVLGRALYLVRIPTMTLEEFANGAAQSDILTLEETHSIFLWYTATN----KPRL 376

  Fly   325 QLKMALTTEQKPPLPSESRR 344
            ...:   |::|...|....|
Human   377 DFPL---TKRKGLAPQRCHR 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11714NP_001027123.1 BTB 27..131 CDD:279045 33/106 (31%)
BTB 29..133 CDD:197585 34/106 (32%)
BTBD6NP_001374496.1 BTB_POZ_BTBD6 128..236 CDD:349658 36/118 (31%)
BACK_BTBD6 236..330 CDD:350600 27/146 (18%)
PHR 392..537 CDD:400388 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.