DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11714 and btbd3b

DIOPT Version :9

Sequence 1:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster
Sequence 2:XP_003199784.1 Gene:btbd3b / 562593 ZFINID:ZDB-GENE-041210-282 Length:517 Species:Danio rerio


Alignment Length:315 Identity:77/315 - (24%)
Similarity:123/315 - (39%) Gaps:70/315 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DCTFIIEDESGGSQSFPCHKLLFSCASDVFDRMLYGDYIESTSGVVRLNDVQPDIFEKFRDYVYG 93
            |..|:: .:|||:|..|.||.:.:..|.||..|.||:..|.|. .:|:.||:|..|.....|:| 
Zfish   116 DVHFVV-GQSGGTQRLPGHKYVLAVGSSVFHAMFYGELAEDTD-EIRIPDVEPPAFLAMLKYIY- 177

  Fly    94 YECDKLQKYDFDTLIRLCEFANKYLVQSLEEDCVKDL---LIRKNTFDMGELLRLFQCAHRMNRK 155
              ||::. ...||::.....|.||:|..|...||..|   |..||.           |.      
Zfish   178 --CDEID-LSADTVLATLYAAKKYIVPHLARACVNFLETSLSAKNA-----------CI------ 222

  Fly   156 SLINQIAWELKCTFKSTLDHSGVYEFNCEVFKHYIEVIASKISEADRFRLLEMYLKYNGIEELES 220
             |::|     .|.|:..           ::.:...|||.::         .|:.||.:|..:   
Zfish   223 -LLSQ-----SCLFEEP-----------DLTQRCWEVIDAQ---------AELALKSDGFCD--- 258

  Fly   221 AGQVDSQDATEANTTTITTTNEVENQESELPSTSCVPLKTECSFAVPNKKASFVSDLLALIDFGK 285
               :|||..............|:...|:.|........:.|.:.::.||: ..:...:.||....
Zfish   259 ---IDSQTLESILRRETLNAKEIVVFEAALSWADAECQRREMNTSIDNKR-KVLGQSIYLIRIPT 319

  Fly   286 LSPKEFYDGPGKSNFLSLAEKYEHM--YQIAKNCVTAKDELQL----KMALTTEQ 334
            :...:|.:|..:|..|:|.|..:..  |..||     |.|||.    :..||.::
Zfish   320 MGLDDFANGAAQSGVLTLNETNDIFLWYTAAK-----KPELQFASQPRKGLTPQK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11714NP_001027123.1 BTB 27..131 CDD:279045 36/104 (35%)
BTB 29..133 CDD:197585 37/106 (35%)
btbd3bXP_003199784.1 BTB 108..211 CDD:279045 35/100 (35%)
BTB 116..215 CDD:197585 36/104 (35%)
BACK 221..327 CDD:197943 24/144 (17%)
PHR 372..515 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.