DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11714 and BTBD2

DIOPT Version :9

Sequence 1:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_060267.2 Gene:BTBD2 / 55643 HGNCID:15504 Length:525 Species:Homo sapiens


Alignment Length:272 Identity:61/272 - (22%)
Similarity:98/272 - (36%) Gaps:74/272 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SQSFPCHKLLFSCASDVFDRMLYGDYIESTSGVVRLNDVQPDIFEKFRDYVYGYECDKLQKYDFD 105
            ||..|.|:.:.:..|.|||.|..|. :.:||..:.|.||:|..|.....::|.   |::| ...:
Human   129 SQRIPAHRFVLAVGSAVFDAMFNGG-MATTSTEIELPDVEPAAFLALLKFLYS---DEVQ-IGPE 188

  Fly   106 TLIRLCEFANKYLVQSLEEDCVKDL---LIRKNTFDMGELLRLFQ-------CAHRMNRKSLINQ 160
            |::.....|.||.|.:||..||:.|   |...|.|.:....|||.       |...::       
Human   189 TVMTTLYTAKKYAVPALEAHCVEFLKKNLRADNAFMLLTQARLFDEPQLASLCLENID------- 246

  Fly   161 IAWELKCTFKSTLDHSGVYEFNCEVFKHYIEVIASKISEADRFRLLEMYLKYNGIEELESAGQVD 225
                     |:|.|                .:.|...::.|             ::.|.:..:.|
Human   247 ---------KNTAD----------------AITAEGFTDID-------------LDTLVAVLERD 273

  Fly   226 SQDATEANT-TTITTTNEVENQESELPSTSCVPLKTECSFAVPNKKASFVSDLLALIDFGKLSPK 289
            :....|... ..:...:|.|.|..:|..|             |..:...:...|.||.|..::.:
Human   274 TLGIREVRLFNAVVRWSEAECQRQQLQVT-------------PENRRKVLGKALGLIRFPLMTIE 325

  Fly   290 EFYDGPGKSNFL 301
            ||..||.:|..|
Human   326 EFAAGPAQSGIL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11714NP_001027123.1 BTB 27..131 CDD:279045 30/92 (33%)
BTB 29..133 CDD:197585 31/94 (33%)
BTBD2NP_060267.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86
BTB 110..214 CDD:279045 29/89 (33%)
BTB 118..217 CDD:197585 30/92 (33%)
BACK 229..328 CDD:197943 23/156 (15%)
PHR 376..523 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.