DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11714 and btbd6b

DIOPT Version :9

Sequence 1:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster
Sequence 2:XP_005160551.1 Gene:btbd6b / 553533 ZFINID:ZDB-GENE-030829-65 Length:535 Species:Danio rerio


Alignment Length:334 Identity:81/334 - (24%)
Similarity:130/334 - (38%) Gaps:68/334 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TLPNSKMRSCMM---ELGRTNRHTDCTFIIEDESGGSQSFPCHKLLFSCASDVFDRMLYGDYIES 69
            |.|..:.|:.:|   ||     ..|..|:: ...|.||..|.||.:.:..|.||..|.|||..|.
Zfish   115 THPTLRERNALMFNNEL-----MADVHFVV-GPPGASQKVPAHKYVLAVGSSVFGAMFYGDLAEG 173

  Fly    70 TSGVVRLNDVQPDIFEKFRDYVYGYECDKLQKYDFDTLIRLCEFANKYLVQSLEEDCVKDL---L 131
            .| .:.:.||:|..|.....|:|..|.:    .:.||::.....|.||:|.:|.:.||..|   |
Zfish   174 ES-EIHIPDVEPAAFLILLKYMYSDEIE----LEADTVLATLYAAKKYIVPALAKACVTFLETSL 233

  Fly   132 IRKNTFDMGELLRLFQCAHRMNRKSLINQIAWELKCTFKSTLDHSGVYEFNCEVFKHYIEVIASK 196
            ..||...:....|||:       :..:....||:.........||   |..||:....:|:|..:
Zfish   234 EAKNACVLLSQSRLFE-------EPELTLRCWEVIDAQAELALHS---EGFCEIDLQTLEIILKR 288

  Fly   197 ISEADRFRLLEMYLKYNGIEELESAGQVDSQDATEANTTTITTTNEVENQESELPSTSCVPLKTE 261
                               |.|.:...|..|.|.:...        .|.:...|..|:       
Zfish   289 -------------------ETLNTREAVVFQAALDWAV--------AECKRQGLGPTA------- 319

  Fly   262 CSFAVPNKKASFVSDLLALIDFGKLSPKEFYDGPGKSNFLSLAEKYE-HMYQIAKNCVTAKDELQ 325
                 .||:| .:...|.|:....::.:||.:|..:|:.|:|.|.:: .::..|.|....:..||
Zfish   320 -----RNKRA-VLGKALYLVRIPTMTLEEFANGAAQSDVLTLEETHDVFLWYTAANKPKLEFPLQ 378

  Fly   326 LKMALTTEQ 334
            .:..||.::
Zfish   379 KRKGLTPQR 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11714NP_001027123.1 BTB 27..131 CDD:279045 34/106 (32%)
BTB 29..133 CDD:197585 35/106 (33%)
btbd6bXP_005160551.1 BTB 126..229 CDD:279045 36/113 (32%)
BTB 134..233 CDD:197585 34/104 (33%)
BACK 239..345 CDD:197943 27/155 (17%)
PHR 390..533 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.