DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11714 and BTBD17

DIOPT Version :9

Sequence 1:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster
Sequence 2:XP_011523093.1 Gene:BTBD17 / 388419 HGNCID:33758 Length:479 Species:Homo sapiens


Alignment Length:164 Identity:41/164 - (25%)
Similarity:64/164 - (39%) Gaps:22/164 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MMELGRTNRHTDCTFIIEDESGGSQS---FPCHKLLFSCASDVFDRMLYGDYIESTSGVVRLNDV 79
            :.||.|....:|  .::..::.|:..   |..|:||....|::|..:|      |......|.:.
Human    54 LQELLRQGNASD--VVLRVQAAGTDEVRVFHAHRLLLGLHSELFLELL------SNQSEAVLQEP 110

  Fly    80 Q--PDIFEKFRDYVYGYECDKLQKYDFDTLIRLCEFANKYLVQSLEEDCVKDLLIRKNTFDMGEL 142
            |  ..:|:||..|:|   |.:|... ....|.|...|.||.|.||:.. |.|.:........|..
Human   111 QDCAAVFDKFIRYLY---CGELTVL-LTQAIPLHRLATKYGVSSLQRG-VADYMRAHLAGGAGPA 170

  Fly   143 LRLFQCA----HRMNRKSLINQIAWELKCTFKST 172
            :..:..|    ....|:|.:..:||.|.....||
Human   171 VGWYHYAVGTGDEALRESCLQFLAWNLSAVAAST 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11714NP_001027123.1 BTB 27..131 CDD:279045 29/108 (27%)
BTB 29..133 CDD:197585 29/108 (27%)
BTBD17XP_011523093.1 BTB 54..159 CDD:279045 32/117 (27%)
BTB 65..163 CDD:197585 29/110 (26%)
BACK 170..268 CDD:197943 8/35 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.