DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11714 and CG17068

DIOPT Version :9

Sequence 1:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster


Alignment Length:376 Identity:85/376 - (22%)
Similarity:136/376 - (36%) Gaps:114/376 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TNRHTDCTFIIEDESGGSQSFPCHKLLFSCASDVFDRMLYGDYIESTSGVVRLNDVQPDIFEKFR 88
            :.:..||.|:: ..|...:....||||.:.||.||:||.||:..:.|..:| :.||||:.||...
  Fly    22 SEKWADCRFLV-GSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKTDPIV-IPDVQPEAFEAML 84

  Fly    89 DYVYGYECDKLQKYDFDTLIRLCEFANKYLVQSLEEDCVKDL---LIRKNTFDMGELLRLFQCAH 150
            :|:|   .|::....||....||..|.||::..:...|...|   |..||.....|..:||....
  Fly    85 EYIY---TDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNACRAYEFAKLFDEPR 146

  Fly   151 RMNRKSLINQIAWELK-------------CTFKSTLDHSGVYEFNCEVFKHYIEVIASKISEADR 202
            .|  :|.::.||...:             .|..:.||.:   ..|.:             ||.|.
  Fly   147 LM--QSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQN---RLNID-------------SELDL 193

  Fly   203 FRLLEMYLKYNGI------EELESAGQVDSQDATEANTTTITTTNEVE------------NQESE 249
            |..|..:....||      ||..|.|||.::::.: |........|::            :|:.|
  Fly   194 FNCLLKFASERGILNESGQEETASGGQVLTKESPD-NAAGHVLVEEIKMEPDVAAMVQHMHQDDE 257

  Fly   250 LPSTSCVPLKTECSFAVPNKKASFV----------------SDLLALID---------------- 282
            ..|     .:|:...|..:..|:..                ||.|.:||                
  Fly   258 ADS-----FETDAGMASTSSAAAAAAAAPTAASPPLDVASGSDDLVIIDSDASADAAANMINIMD 317

  Fly   283 -------------------FGKLSPKEFYDGPGKSNFLSLAEKYEHMYQIA 314
                               |..::|::|.:||.:|..|...|....:.:|:
  Fly   318 AQRTILDGAMLRQAVKKIRFLTMTPQQFAEGPARSKLLQQHEALSILIKIS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11714NP_001027123.1 BTB 27..131 CDD:279045 36/106 (34%)
BTB 29..133 CDD:197585 37/106 (35%)
CG17068NP_608379.1 BTB 19..123 CDD:279045 35/105 (33%)
BTB 27..127 CDD:197585 36/104 (35%)
BACK 136..>199 CDD:197943 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.