DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11714 and Tango10

DIOPT Version :9

Sequence 1:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001259461.1 Gene:Tango10 / 32125 FlyBaseID:FBgn0030330 Length:587 Species:Drosophila melanogaster


Alignment Length:365 Identity:71/365 - (19%)
Similarity:133/365 - (36%) Gaps:111/365 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TDCTFIIEDESGGSQSFPCHKLLFSCASDVFDRMLYG-DYIESTSGVVRLNDVQ--PDIFEKFRD 89
            :|...:::     .:.||.|:::...:||||..||.. ::.|.:..|:.|::..  ..:|.:|..
  Fly   143 SDIVLLVD-----GKEFPAHRVILCASSDVFQVMLMNPEWNECSKHVIELHEEACCSAVFPQFIK 202

  Fly    90 YVYGYECD-KLQ----------KYDFDTLIRLC-EFANKYLVQSLEEDCVKDLLIRKNTF----- 137
            |:|..:.: .||          ||:...||.|| ::.||::.::.....:...|....:|     
  Fly   203 YLYVGQIEVTLQTVMPMLALSDKYNIRDLIDLCVDYMNKHVAKAATSGYLVSWLQYTLSFTPTHN 267

  Fly   138 DMGELLRLFQCAHRMNRKSLINQIAWELKCTFKSTLDHSGVYEFNCEVFKHYIEVIASKI----- 197
            |:.|.|:.|              :.|.|:...:|               :.::|:..:.:     
  Fly   268 DLTETLKRF--------------LKWNLEMVAES---------------RDFVEMDPAILILLLQ 303

  Fly   198 -------SEADRFRLLEMYLKYNGIEELESAGQVDSQDATEANTTTITTTNEVENQESELPSTSC 255
                   ||...|.:|:.:|.:.. |::|:.|.....:..|...:.|........|.|.|.....
  Fly   304 QNDLVVTSEYKLFDILQTWLLHRR-EQMEATGSGGFMELIEQTVSHIRFGMMTPRQLSHLLMDPL 367

  Fly   256 VPLKTECSFAVPNKKASFVSDLLAL-----------------IDFGKL--SPKEFYDGPGK---- 297
            |....|           |:.:.:|:                 .:.|||  :|:.:::....    
  Fly   368 VEYHKE-----------FLVERIAIGMSYQSGHEDRVREVRATESGKLQFTPRLYWNDTWSVDID 421

  Fly   298 -SNFLSLAEKYEHMYQIAKNCVTAKDELQLKMALTTEQKP 336
             .||.:: |.|       ||.||.... |..:|.|.|..|
  Fly   422 VHNFTAI-EDY-------KNYVTCFFS-QRHIAETEEDDP 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11714NP_001027123.1 BTB 27..131 CDD:279045 27/117 (23%)
BTB 29..133 CDD:197585 28/118 (24%)
Tango10NP_001259461.1 BTB 135..239 CDD:279045 25/100 (25%)
BTB 144..242 CDD:197585 26/102 (25%)
BACK 258..359 CDD:197943 19/130 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24410
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.