DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11714 and Btbd1

DIOPT Version :9

Sequence 1:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001011932.1 Gene:Btbd1 / 293060 RGDID:1310962 Length:488 Species:Rattus norvegicus


Alignment Length:270 Identity:68/270 - (25%)
Similarity:101/270 - (37%) Gaps:62/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SGGSQSFPCHKLLFSCASDVFDRMLYGDYIESTSGVVRLNDVQPDIFEKFRDYVYGYECDKLQKY 102
            :||.|..|.|:.:.:..|.|||.|..|. :.:||..:.|.||:|..|.....::|.   |::| .
  Rat    90 AGGPQRIPAHRFVLAAGSAVFDAMFNGG-MATTSAEIELPDVEPAAFLALLRFLYS---DEVQ-I 149

  Fly   103 DFDTLIRLCEFANKYLVQSLEEDCVKDLLIR----KNTFDMGELLRLFQCAHRMNRKSLINQIAW 163
            ..:|::.....|.||.|.:||..|| |.|.:    .|.|.:....|||.              ..
  Rat   150 GPETVMTTLYTAKKYAVPALEAHCV-DFLTKHLRADNAFMLLTQARLFD--------------EP 199

  Fly   164 ELKCTFKSTLDHSGVYEFNCEVFKHY-IEVIASKISEADRFRLLEMYLKYNGIEELESAGQVDSQ 227
            :|......|:|.|.|...:.|.|... |:.:.: :.|.|...:.|..|                 
  Rat   200 QLASLCLDTIDKSTVDAISAEGFTDIDIDTLCA-VLERDTLSIRESRL----------------- 246

  Fly   228 DATEANTTTITTTNEVENQESELPSTSCVPLKTECSFAVPNKKASFVSDLLALIDFGKLSPKEFY 292
                  ...|....|.|.|..:||.|.             ..|...:...|:||.|..::.:||.
  Rat   247 ------FGAIVRWAEAECQRQQLPVTF-------------GNKQKVLGKALSLIRFPLMTIEEFA 292

  Fly   293 DGPGKSNFLS 302
            .||.:|..||
  Rat   293 AGPAQSGILS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11714NP_001027123.1 BTB 27..131 CDD:279045 31/92 (34%)
BTB 29..133 CDD:197585 32/94 (34%)
Btbd1NP_001011932.1 BTB 68..177 CDD:279045 31/92 (34%)
BTB 94..181 CDD:197585 30/92 (33%)
BACK 193..292 CDD:197943 28/149 (19%)
PHR 340..486 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.