DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11714 and Btbd3

DIOPT Version :9

Sequence 1:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_663509.2 Gene:Btbd3 / 228662 MGIID:2385155 Length:530 Species:Mus musculus


Alignment Length:346 Identity:82/346 - (23%)
Similarity:133/346 - (38%) Gaps:83/346 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PNSKMRSCMMELGRTNRHTDCTFIIEDESGGSQSFPCHKLLFSCASDVFDRMLYGDYIESTSGVV 74
            |..:.|:.:|  ...:...|..|:: ...||:|..|.||.:.:..|.||..|.||:..|. ...:
Mouse   112 PTIRERNAVM--FNNDLMADVHFVV-GPPGGTQRLPGHKYVLAVGSSVFHAMFYGELAED-KDEI 172

  Fly    75 RLNDVQPDIFEKFRDYVYGYECDKLQKYDFDTLIRLCEFANKYLVQSLEEDCVKDL---LIRKNT 136
            |:.||:|..|.....|:|   ||::. ...||::.....|.||:|..|...||..|   |..||.
Mouse   173 RIPDVEPAAFLAMLKYIY---CDEID-LAADTVLATLYAAKKYIVPHLARACVNFLETSLSAKNA 233

  Fly   137 FDMGELLRLFQCAHRMNRKSLINQIAWELKCTFKSTLDHSGVYEFNCEVFKHYIEVIASKISEAD 201
                       |.       |::|     .|.|:..           ::.:...|||.::     
Mouse   234 -----------CV-------LLSQ-----SCLFEEP-----------DLTQRCWEVIDAQ----- 259

  Fly   202 RFRLLEMYLKYNG-----IEELESAGQVDSQDATEANT-TTITTTNEVENQESELPSTSCVPLKT 260
                .|:.||..|     .:.|||..:.::.:|.|... .......|||.|..:|          
Mouse   260 ----AELALKSEGFCDIDFQTLESILRRETLNAKEIVVFEAALNWAEVECQRQDL---------- 310

  Fly   261 ECSFAVPNKKASFVSDLLALIDFGKLSPKEFYDGPGKSNFLSLAEKYEHM--YQIAKNCVTAKDE 323
              :.::.||: ..:...|.||....::..:|.:|..:|..|:|.|..:..  |..:|     |.|
Mouse   311 --ALSIENKR-KVLGKALYLIRIPTMALDDFANGAAQSGVLTLNETNDIFLWYTASK-----KPE 367

  Fly   324 LQLKMALTTEQKPPLPSESRR 344
            ||.   ::..:|..:|....|
Mouse   368 LQF---VSKARKGLVPQRCHR 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11714NP_001027123.1 BTB 27..131 CDD:279045 34/106 (32%)
BTB 29..133 CDD:197585 35/106 (33%)
Btbd3NP_663509.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..48
BTB 121..224 CDD:279045 34/110 (31%)
BTB 129..228 CDD:197585 34/104 (33%)
BACK 234..340 CDD:197943 28/150 (19%)
PHR 385..528 CDD:285277 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.