DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11714 and tag-30

DIOPT Version :9

Sequence 1:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001379158.1 Gene:tag-30 / 178116 WormBaseID:WBGene00006415 Length:602 Species:Caenorhabditis elegans


Alignment Length:230 Identity:55/230 - (23%)
Similarity:88/230 - (38%) Gaps:61/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DCTFIIE-DESGGSQSFPCHKLLFSCASDVFDRMLYGDYIESTSG---VVRLNDVQPDIFEKFRD 89
            |..|::. |:|  .|..|.||.:.|..|.|||.|..|......:.   .:.|.||:|..|.....
 Worm   190 DVFFVVGIDDS--RQRIPAHKFVLSIGSVVFDAMFNGGLTPKNTEEALEIELPDVEPSAFLALLK 252

  Fly    90 YVYGYECDKLQKYDFDTLIRLCEFANKYLVQSLEEDCV---KDLLIRKNTFDMGELLRLF----- 146
            ::|..|.    |.:.::::.....|.||.|.::|::||   |..|:..|.|.|....:||     
 Worm   253 FLYSDEV----KIEAESVMTTLYTAKKYAVPAMEKECVRFLKQRLVPDNAFMMLSQAKLFDEPDL 313

  Fly   147 --QCAHRMNRKSLINQIAWELKCTFKSTLDHSGVYEFN----CEVFKHYIEVIASKISEADRFRL 205
              :|...:::.:|             ..|:..|..|.:    |||...            |..|:
 Worm   314 MQKCLEVIDKNTL-------------EALNGEGFTEIDLDTLCEVLTR------------DGLRI 353

  Fly   206 LEMYL--------KYNGIEELESAGQVDSQDATEA 232
            .|::|        |:    |.|..|...:.|:..|
 Worm   354 REIFLFQAVLRWAKF----EAERRGMPANGDSRRA 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11714NP_001027123.1 BTB 27..131 CDD:279045 31/108 (29%)
BTB 29..133 CDD:197585 32/110 (29%)
tag-30NP_001379158.1 BTB_POZ_BTBD1_2 167..297 CDD:349590 32/112 (29%)
BACK_BTBD1_like 293..387 CDD:350562 24/121 (20%)
PHR 453..598 CDD:400388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.