DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11714 and CG43120

DIOPT Version :9

Sequence 1:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001246754.1 Gene:CG43120 / 12798252 FlyBaseID:FBgn0262580 Length:286 Species:Drosophila melanogaster


Alignment Length:274 Identity:67/274 - (24%)
Similarity:125/274 - (45%) Gaps:53/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SFPCHKLLFSCASDVFDRMLYGDYIESTSGVVRLNDVQPDIFEKFRDYVYGYECDKLQKYDFDTL 107
            ||.|||::.:|||:.|:|:...|     |....|:...|::|:.|.|::|....|:....:.|.|
  Fly    30 SFRCHKIILACASEFFERLFQED-----SEEFLLDGTTPEVFQIFLDFIYAPNDDQFGNLEPDVL 89

  Fly   108 IRLCEFANKYLVQSLEEDCVKDLLIRKNTFDMGELLRLFQCAHRMNRKSLINQIAWELKCTFKST 172
            :.|.:.||.:|...:||.|:..||......|...|:.||..:|.::.|.|:.|....|:..:::.
  Fly    90 MCLLKCANMWLAVEIEERCIDILLDLSPDMDPDALIALFAVSHCVDHKVLMEQSIGVLQHIWRNE 154

  Fly   173 LDHSGVYEFNCEVFKHYIEVIASKISEADRFRLLEMYLKYNGIEELESAGQVDSQDATEANTTTI 237
            :|.........:.|..|.:..:..:|...||.::|.::|                          
  Fly   155 MDCPSTVRMEVDCFGEYFKNTSGMLSPRRRFVMVENWIK-------------------------- 193

  Fly   238 TTTNEVENQESELPSTSCVPLKTECSFAVPNKKASFVSDLLALIDFGKLSPKEFYDGPGKSNFLS 302
              .|::.|:                    |..:...::.::..|:|.::|.::||:||||||.|.
  Fly   194 --GNDLNNR--------------------PCSQKDKINQIIKSINFLEMSLEDFYNGPGKSNVLP 236

  Fly   303 LAEKYEHMYQIAKN 316
            .::|:|.||::|::
  Fly   237 DSDKFEIMYKLARS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11714NP_001027123.1 BTB 27..131 CDD:279045 28/87 (32%)
BTB 29..133 CDD:197585 30/89 (34%)
CG43120NP_001246754.1 BTB 12..113 CDD:279045 28/87 (32%)
BTB 21..116 CDD:197585 30/90 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24410
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.