DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11714 and Spopfm2

DIOPT Version :10

Sequence 1:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001139579.1 Gene:Spopfm2 / 100043188 MGIID:3702972 Length:357 Species:Mus musculus


Alignment Length:126 Identity:32/126 - (25%)
Similarity:52/126 - (41%) Gaps:18/126 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SIWPIRTLPNSKMRSCMMELGRTNRHTDCTFIIEDESGGSQSFPCHKLLFSCASDVFDRMLYGDY 66
            :|.|....|...:...:.||...:..|||...:     ..|.|..||.:.:..|.||..|...:.
Mouse   162 NITPAIKDPRHMIADDLGELWENSLCTDCCLFV-----AGQEFRAHKAILAARSPVFRAMFEHEM 221

  Fly    67 IESTSGVVRLNDVQPDIFEKFRDYVY----------GYECDKL---QKYDFDTLIRLCEFA 114
            :|..:..|.:||:.|.:|::...::|          ...||.|   .:|..:.|:.|||.|
Mouse   222 VERLTNRVDINDLDPKVFKEMMGFIYTGKAPHLHIHSMACDLLAAADRYGMEGLMVLCEDA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11714NP_001027123.1 BTB_POZ_ZBTB_KLHL-like 27..117 CDD:349497 27/101 (27%)
Spopfm2NP_001139579.1 MATH 16..153 CDD:445786
BTB_POZ 165..292 CDD:453885 31/123 (25%)
BACK 287..351 CDD:475122
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.