DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33844 and h2ax

DIOPT Version :10

Sequence 1:NP_001027351.1 Gene:His2A:CG33844 / 3772565 FlyBaseID:FBgn0053844 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_957367.1 Gene:h2ax / 394048 ZFINID:ZDB-GENE-040426-987 Length:142 Species:Danio rerio


Alignment Length:125 Identity:110/125 - (88%)
Similarity:118/125 - (94%) Gaps:1/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| |||.:.|||:||:||||||||||:||||||||||||||||||||||||:|||.||:||
Zfish     1 MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 124
            ||||||||||||||||||||||:||||||||||.||||||||||||||||||||||.:.|
Zfish    66 LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTGQAA 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33844NP_001027351.1 PTZ00017 16..124 CDD:185399 97/107 (91%)
h2axNP_957367.1 PTZ00017 1..121 CDD:185399 107/119 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 14/20 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..142 1/3 (33%)
[ST]-Q motif 139..140
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.