DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33844 and H2AX

DIOPT Version :10

Sequence 1:NP_001027351.1 Gene:His2A:CG33844 / 3772565 FlyBaseID:FBgn0053844 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_002096.1 Gene:H2AX / 3014 HGNCID:4739 Length:143 Species:Homo sapiens


Alignment Length:121 Identity:110/121 - (90%)
Similarity:116/121 - (95%) Gaps:1/121 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRGK-GGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLE 64
            |||||| |||.:.||||||:||||||||||:|||||||:||||||||||||||||:|||.||:||
Human     1 MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILE 65

  Fly    65 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT 120
            |||||||||||||||||||||||||||||||||.||||||||||||||||||||||
Human    66 LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKT 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33844NP_001027351.1 PTZ00017 16..124 CDD:185399 98/105 (93%)
H2AXNP_002096.1 PTZ00017 1..131 CDD:185399 110/121 (91%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 15/20 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..143 1/1 (100%)
[ST]-Q motif 140..141
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.