powered by:
Protein Alignment His2A:CG33844 and H2AC1
DIOPT Version :10
| Sequence 1: | NP_001027351.1 |
Gene: | His2A:CG33844 / 3772565 |
FlyBaseID: | FBgn0053844 |
Length: | 124 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_734466.1 |
Gene: | H2AC1 / 221613 |
HGNCID: | 18729 |
Length: | 131 |
Species: | Homo sapiens |
| Alignment Length: | 67 |
Identity: | 19/67 - (28%) |
| Similarity: | 23/67 - (34%) |
Gaps: | 28/67 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 114 KKQSGLHRGSWSQRDAEQRRTNKRYEAFALPEPAPRVLPKNEDPKLVNRNRRMLGNLLGTLEKFR 178
|..|||.||..|.: |...:.||:|.. |.||.|.||.:
Human 263 KSTSGLLRGGGSVK---------------LSTLSMRVIPVG-------------GQLLCTCEKIQ 299
Fly 179 KE 180
||
Human 300 KE 301
|
Known Domains:
Indicated by green bases in alignment.
Return to query results.
Submit another query.