DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33844 and H2AC1

DIOPT Version :10

Sequence 1:NP_001027351.1 Gene:His2A:CG33844 / 3772565 FlyBaseID:FBgn0053844 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_734466.1 Gene:H2AC1 / 221613 HGNCID:18729 Length:131 Species:Homo sapiens


Alignment Length:67 Identity:19/67 - (28%)
Similarity:23/67 - (34%) Gaps:28/67 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KKQSGLHRGSWSQRDAEQRRTNKRYEAFALPEPAPRVLPKNEDPKLVNRNRRMLGNLLGTLEKFR 178
            |..|||.||..|.:               |...:.||:|..             |.||.|.||.:
Human   263 KSTSGLLRGGGSVK---------------LSTLSMRVIPVG-------------GQLLCTCEKIQ 299

  Fly   179 KE 180
            ||
Human   300 KE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33844NP_001027351.1 PTZ00017 16..124 CDD:185399 6/9 (67%)
H2AC1NP_734466.1 PTZ00017 1..131 CDD:185399
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.