DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33644 and CG12849

DIOPT Version :9

Sequence 1:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:126 Identity:20/126 - (15%)
Similarity:50/126 - (39%) Gaps:8/126 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IECPIHSPEYVQNFSCRLHKKSPNSGSKSFSAEFSL-RKEVNDVRGAYVFSFKQGKSIINYTAME 71
            :.|.:....::....|.|  ||.|...|..|.:..: |..|::....:....::.:.::.....:
  Fly    26 VVCLVRDRMFMDFEYCYL--KSVNRTYKYLSLKTKMFRLPVDNCETRFQLRMRENRRVLYNFDFK 88

  Fly    72 IDYCQALSALQSQILFKLIADELRRVSNFPLNCPFVMNKRYYVDEFTIN--PKVIPSYTPE 130
            :|.|:.:.. :..::...:.......||....||:  :....:|:..:.  .|::.|..|:
  Fly    89 VDSCKFMRD-RKHVIANWVYQTFGPYSNLNHTCPY--DHDIVLDKLPVQHLNKLVQSIIPD 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33644NP_001027259.1 DUF1091 50..133 CDD:284008 10/83 (12%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 10/70 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.