DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33644 and CG33648

DIOPT Version :9

Sequence 1:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:158 Identity:42/158 - (26%)
Similarity:62/158 - (39%) Gaps:30/158 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TQIECPIHSPEYVQNFSCRLHKKSPNSGSK--SFSAEFSLRKEVNDVRGAYVFSFKQGKSIINYT 68
            |.|:|......||...|||:  ||.|...|  |.::...:....|......::....|.....|.
  Fly    26 TNIKCSSSDTSYVYYESCRI--KSVNRTYKYISVNSRLLILPLTNATINVALYKRYNGYKPFLYN 88

  Fly    69 AMEIDYCQALSALQSQILFKLIADELRRVSNF--PLNCPFVMNKRYYVDEFTIN------PKVIP 125
             :.:|.|:.|...:|.|:.|.:.|.:...||.  | .|||  |....||:.|.|      .:|:|
  Fly    89 -VSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSP-TCPF--NSFISVDKLTTNFLNNKLTQVLP 149

  Fly   126 SYTPE------------MIFTSDCNIFI 141
              .||            .|:.|..|::|
  Fly   150 --VPEGDYLFAFRWFSYNIYRSSVNVYI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33644NP_001027259.1 DUF1091 50..133 CDD:284008 24/102 (24%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.