DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33644 and CG33647

DIOPT Version :9

Sequence 1:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster


Alignment Length:157 Identity:70/157 - (44%)
Similarity:105/157 - (66%) Gaps:5/157 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MTQIECPIHSPEYVQNFSCRLHKKSPNSGSKSFSAEFSLRKEVNDVRGAYVFSFKQGKSIINYTA 69
            ||:|||..:.||.|:|.||.|::.|..:|  |..|||.|.::|.|::|.|:.:||:|..:.|:|:
  Fly    30 MTKIECLNYMPELVRNVSCYLNETSHPTG--SIYAEFILTQDVEDLKGIYILTFKRGSYVTNFTS 92

  Fly    70 MEIDYCQALSALQSQILFKLIADELRRVSNFPLNCPFVMNKRYYVDEFTINPKVIPSYTPEMIFT 134
            ..:||||.||::::..||:::..:||..:|||:.||..||||||...||:|.|.||||.||..|.
  Fly    93 SHVDYCQMLSSVENHFLFRMVTTQLRETANFPIQCPLKMNKRYYAKGFTVNSKFIPSYMPETNFI 157

  Fly   135 SDCNIFIKKRRAMQLTIHG---RVVRR 158
            ||.::.:|.|:..:|.|.|   |::||
  Fly   158 SDAHLSVKDRKVFRLLIKGRFSRILRR 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33644NP_001027259.1 DUF1091 50..133 CDD:284008 38/82 (46%)
CG33647NP_001027136.1 DUF1091 <95..156 CDD:284008 31/60 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440864
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FA0X
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I7658
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D120800at33392
OrthoFinder 1 1.000 - - FOG0014292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.